PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_35697
Common NameKK1_034612
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 132aa    MW: 14545.3 Da    PI: 7.5048
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_35697genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB138.32e-431781794
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                   mkk+lP n+ki+kdaketvqe vsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+ylk yr+ +
  C.cajan_35697  1 MKKALPPNGKIAKDAKETVQEGVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLKTYRDGD 78
                   9**************************************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008087.5E-20155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471139.72E-30190IPR009072Histone-fold
Gene3DG3DSA:1.10.20.109.2E-40189IPR009072Histone-fold
PRINTSPR006155.5E-191937No hitNo description
PRINTSPR006155.5E-193856No hitNo description
PRINTSPR006155.5E-195775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MKKALPPNGK IAKDAKETVQ EGVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EDYIDPLKIY LKTYRDGDSK GSAKGGDVSG RKEVYPSTNA QLAHQGSFSQ GVNYTNSQPQ  120
AQHMIVPMQG QE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A3e-361761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B3e-361761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A3e-361761893NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150417e-42AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144526.11e-80hypothetical protein PHAVU_007G163100g
SwissprotQ8VYK42e-59NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A151RMZ95e-96A0A151RMZ9_CAJCA; Nuclear transcription factor Y subunit B-8
STRINGGLYMA03G33490.17e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.34e-51nuclear factor Y, subunit B8